Op werkdagen voor 23:00 besteld, morgen in huis Gratis verzending vanaf €20
-
Inloggen

Uw winkelwagen

Naar winkelwagen Verder winkelen
Boek niet gevonden? Wij gaan voor u op zoek!
Vul onderstaand formulier zo volledig mogelijk in, dan gaan wij voor u op zoek.
Vul onderstaand formulier zo volledig mogelijk in.
Contact
010-4091943
Klantenservice
Mijn account
Mijn bestellingen
0318-508539
Boeken Leiderschap The Five Dysfunctions of a Team
The Five Dysfunctions of a Team
The Five Dysfunctions of a Team
The Five Dysfunctions of a Team
The Five Dysfunctions of a Team
Patrick Lencioni

Patrick Lencioni is oprichter en directeur van The Table Group, een bedrijf dat zich sinds 1997 inzet om leiders te helpen de gezondheid van hun organisaties te verbeteren.

Meer over Patrick Lencioni
Patrick Lencioni

The Five Dysfunctions of a Team

A Leadership Fable

Specificaties
Gebonden, 256 blz. | Engels
Jossey Bass | 1e druk, 2002
ISBN13: 9780787960759
Rubricering
Jossey Bass 1e druk, 2002 9780787960759
€ 30,22
In winkelwagen
Op voorraad
Vandaag voor 21:00 besteld, dinsdag in huis
Gratis verzonden
Past door de brievenbus

Samenvatting

A leadership fable that is as compelling and enthralling as it is realistic, relevant, and practical.

In The Five Dysfunctions of a Team, Patrick Lencioni once again offers a leadership fable that is as captivating and instructive as his first two best-selling books, The Five Temptations of a CEO and The Four Obsessions of an Extraordinary Executive. This time, he turns his keen intellect and storytelling power to the fascinating, complex world of teams.

Kathryn Petersen, Decision Tech's CEO, faces the ultimate leadership crisis: Uniting a team in such disarray that it threatens to bring down the entire company. Will she succeed? Will she be fired? Will the company fail? Lencioni's utterly gripping tale serves as a timeless reminder that leadership requires as much courage as it does insight.

Throughout the story, Lencioni reveals the five dysfunctions which go to the very heart of why teams even the best ones-often struggle. He outlines a powerful model and actionable steps that can be used to overcome these common hurdles and build a cohesive, effective team. Just as with his other books, Lencioni has written a compelling fable with a powerful yet deceptively simple message for all those who strive to be exceptional team leaders.

Trefwoorden

teamsteamdynamiekleiderschapdysfunctiesleidinggevenorganisatieveranderingteameffectiviteitvertrouwenmanagementcommunicatieconflictbedrijfscultuurverantwoordelijkheidorganisatiecultuurresultaatgerichtheidpersoonlijk leiderschapsamenwerkenbesluitvorminggroepsdynamiekbetrokkenheidorganisatiecultuurresultaatgerichtheidpersoonlijk leiderschapsamenwerkenbesluitvorminggroepsdynamiekbetrokkenheid
teamsteamdynamiekleiderschapdysfunctiesleidinggevenorganisatieveranderingmanagementteameffectiviteitvertrouwenconflictcommunicatiebedrijfscultuurverantwoordelijkheidorganisatiecultuurbetrokkenheidgroepsdynamiekbesluitvormingsamenwerkenpersoonlijk leiderschapresultaatgerichtheidorganisatiecultuurbetrokkenheidgroepsdynamiekbesluitvormingsamenwerkenpersoonlijk leiderschapresultaatgerichtheid

Specificaties

ISBN13:9780787960759
Taal:Engels
Bindwijze:gebonden
Aantal pagina's:256
Uitgever:Jossey Bass
Druk:1
Verschijningsdatum:22-1-2025
Hoofdrubriek:Leiderschap

Over Patrick Lencioni

Patrick Lencioni is oprichter en directeur van The Table Group, een bedrijf dat zich sinds 1997 inzet om leiders te helpen de gezondheid van hun organisaties te verbeteren. Zijn principes worden omarmd door leiders wereldwijd en zijn overgenomen door allerlei soorten organisaties, waaronder multinationals, startups, professionele sportteams, het leger, non-profitorganisaties, kerken en scholen. Lencioni is de auteur van elf managementboeken met bijna zeven miljoen verkochte exemplaren wereldwijd. Zijn werk is onder meer verschenen in de Wall Street Journal, Harvard Business Review, Fortune, Bloomberg Businessweek en USA Today. Voordat Lencioni The Table Group oprichtte, was hij executive bij Sybase, Inc. Hij begon zijn carrière bij Bain & Company en werkte later bij Oracle Corporation. Lencioni woont met zijn vrouw en hun vier zonen in de San Francisco Bay Area.

Andere boeken door Patrick Lencioni

Bekijk alle boeken

Inhoudsopgave

Introduction

1. The Fable
Luck
Part One: Underachievement
Part Two: Lighting the Fire
Part Three: Heavy Lifting
Part Four: Traction

2. The Model
An Overview of the Model
Team Assessment
Understanding and Overcoming the Five Dysfunctions

A Note About Time: Kathryn's Methods
A Special Tribute to Teamwork
Acknowledgments
About the Author

Vaak samen gekocht

The Five Dysfunctions of a Team
Overcoming The Five Dysfunctions of a Team
€ 62,34
Prijs voor beide

Anderen die dit boek kochten, kochten ook

  • Toolkit voor agile leiders
    Peter Koning
    Toolkit voor agile leiders
    € 38,95
  • Agile and Business Analysis
    Lynda Girvan
    Agile and Business Analysis
    € 26,95
  • The Five Dysfunctions of a Team: Team Assessment
    Patrick Lencioni
    The Five Dysfunctions of a Team: Team Assessment
    € 23,62
  • OCP Oracle Certified Professional Java SE 17 Developer Certification Kit: Exam 1Z0-829
    Jeanne Boyarsky
    OCP Oracle Certified Professional Java SE 17 Developer Certification Kit: Exam 1Z0-829
    € 105,35
  • OCP: Oracle Certified Professional Java SE 8 Programmer II Study Guide
    Jeanne Boyarsky
    OCP: Oracle Certified Professional Java SE 8 Programmer II Study Guide
    € 53,85
  • Domain-Driven Design: Tackling Complexity in the Heart of Software
    Eric Evans
    Domain-Driven Design: Tackling Complexity in the Heart of Software
    € 81,34
€ 30,22
Morgen in huis
Gratis verzonden

Rubrieken

Uw cookie-instellingen
Deze website maakt gebruik van verschillende soorten cookies. Sommige cookies worden geplaatst door diensten van derden die op onze pagina's worden weergegeven. Om deze externe content te kunnen tonen is nodig dat u toestemming geeft voor het zetten van persoonlijke en marketingcookies. U kunt uw toestemming op elk moment wijzigen of intrekken. In onze cookieverklaring vindt u meer informatie.

Functionele cookies
Deze zijn noodzakelijk voor de werking van de website, zonder deze cookies kan de website niet naar behoren werken.

Persoonlijke en marketingcookies
Wij gebruiken cookies voor statistieken om bij te houden en rapportages te krijgen over hoe bezoekers de website gebruiken. Zo kunnen wij onze website verbeteren. Marketingcookies worden gebruikt om bezoekers te volgen wanneer ze verschillende websites bezoeken. Hun doel is advertenties weergeven die zijn toegesneden op en relevant zijn voor de individuele gebruiker.
Op werkdagen voor 23:00 besteld, morgen in huis Gratis verzending vanaf €20

Klantenservice

Contact Voorwaarden

Bezoekadres

Kernreactorstraat 9b
3903 LG  Veenendaal

Postadres

Postbus 623
3900 AP  Veenendaal
DE OPLOSSING VOOR ZORGELOOS EN EFFICIËNT ABONNEMENTENBEHEER
Algemene voorwaarden Privacy Cookies Service & Contact
© 2026 PS Media

    Personen

      Trefwoorden

        The Five Dysfunctions of a Team

        The Five Dysfunctions of a Team
        Patrick Lencioni
        /
        loader
        Recensiebeleid
        AI-book

        Wat is een AI-book?

        Een AI-book is niet een boek dat geschreven is door AI maar een boek dat verrijkt is met AI. Het maakt de inhoud van een boek interactief via WhatsApp, zodat je ermee kunt chatten. Zie het als een razend slimme assistent die het boek perfect begrijpt en er alles uit onthouden heeft. Jij kunt deze assistent alles vragen. Vraag bijvoorbeeld hoe je iets kunt toepassen op jouw persoonlijke situatie, om een korte samenvatting, of wat de belangrijkste inzichten zijn. AI-books zijn alleen te gebruiken via WhatsApp, je hoeft er geen aparte app voor te installeren.
        Meer informatie over AI-books

        ?

        Geef uw beoordeling

        The Five Dysfunctions of a Team

        Verwijder uw beoordeling