Op werkdagen voor 23:00 besteld, morgen in huis Gratis verzending vanaf €20
-
Inloggen

Uw winkelwagen

Naar winkelwagen Verder winkelen
Boek niet gevonden? Wij gaan voor u op zoek!
Vul onderstaand formulier zo volledig mogelijk in, dan gaan wij voor u op zoek.
Vul onderstaand formulier zo volledig mogelijk in.
Contact
010-4091943
Klantenservice
Mijn account
Mijn bestellingen
0318-508539
E-Books IT-management / ICT Privacy & Data Protection Foundation Courseware
Privacy & Data Protection Foundation Courseware
Privacy & Data Protection Foundation Courseware
Privacy & Data Protection Foundation Courseware
Privacy & Data Protection Foundation Courseware
Ruben Zeegers

Ruben Zeegers is security consultant en mede-eigenaar van Security Risk Watch. Hij ondersteunt publieke en private organisaties bij het professionaliseren van fysieke beveiliging, informatiebeveiliging en privacy. Als auteur en podcastmaker van Beveiliging Binnenskamers maakt hij complexe beveiligingsthema’s toegankelijk voor professionals.

Meer over Ruben Zeegers
E-book
Ruben Zeegers

Privacy & Data Protection Foundation Courseware

Specificaties
E-book, 87 blz. Epub met watermerkbeveiliging | Engels
Van Haren Publishing B.V. | 1e druk, 2018
ISBN13: 9789401803618
Rubricering
Van Haren Publishing B.V. Epub met watermerkbeveiliging 1e druk, 2018 9789401803618
Paperback | EN € 111,28 E-book | EN € 83,33
€ 83,33
In winkelwagen
Direct te downloaden

Samenvatting

'Privacy & Data Protection Foundation' covers the main subjects related to the protection of personal data. Candidates benefit from a certification that is designed to impart all the required knowledge to help ensure compliancy to the General Data Protection Regulation.

Within the European Union regulations and standards regarding the protection of data are stringent. The General Data Protection Regulation (GDPR) went into force in May 2016 and organizations have until May 2018 to change their policies and processes to ensure they fully comply. Companies outside Europe will also need to comply when doing business in Europe.

One of the solutions to comply in time is to qualify staff. Having certified professionals with the right level of knowledge can help prepare your organization to face these opportunities. The EXIN Privacy & Data Protection program covers the required knowledge of legislation and regulations relating to data protection and how this knowledge should be used to be compliant.

Trefwoorden

gdprprivacydata protectioncompliancegegevensbeschermingpersoonsgegevenswetgevingeuropees rechtdataprivacydatalekkeninformation securityrechten van betrokkenendataprotectieorganisatietoezichtdata processingcertificeringverantwoordingsplichtdata protection by designrisicomanagementdata protection impact assessment (dpia)privacy by designverantwoordingsplichtdata protection by designrisicomanagementdata protection impact assessment (dpia)privacy by design
gdprprivacydata protectiongegevensbeschermingpersoonsgegevenscompliancewetgevingdatalekkeninformation securityeuropees rechtdataprivacyorganisatierechten van betrokkenendataprotectiecertificeringtoezichtdata processingdata protection by designverantwoordingsplichtrisicomanagementprivacy by designdata protection impact assessment (dpia)data protection by designverantwoordingsplichtrisicomanagementprivacy by designdata protection impact assessment (dpia)

Specificaties

ISBN13:9789401803618
Taal:Engels
Bindwijze:e-book
Beveiliging:watermerk
Bestandsformaat:epub
Aantal pagina's:87
Uitgever:Van Haren Publishing B.V.
Druk:1
Verschijningsdatum:14-11-2018
Hoofdrubriek:IT-management / ICT
Jongbloed:Staatsrecht - Grondrechten - Privacy(recht) incl. datalekken

Over Ruben Zeegers

ing. Ruben Zeegers CISSP CBP

Andere boeken door Ruben Zeegers

Bekijk alle boeken

Anderen die dit e-book kochten, kochten ook

  • Information Security Management Professional based on ISO/IEC 27001 Courseware – English
    Ruben Zeegers
    Information Security Management Professional based on ISO/IEC 27001 Courseware – English
    € 119,85
  • Privacy & Data Protection Essentials Courseware
    Ruben Zeegers
    Privacy & Data Protection Essentials Courseware
    € 57,50
  • Certified BIO Professional - Baseline Informatiebeveiliging Overheid - Courseware
    Ruben Zeegers
    Certified BIO Professional - Baseline Informatiebeveiliging Overheid - Courseware
    € 99,31
  • Certified BIO2 Professional – Foundation (CBP-F)
    Ruben Zeegers
    Certified BIO2 Professional – Foundation (CBP-F)
    € 106,22
  • Adaptive Systems with Domain-Driven Design, Wardley Mapping, and Team Topologies
    Susanne Kaiser
    Adaptive Systems with Domain-Driven Design, Wardley Mapping, and Team Topologies
    € 49,08
  • Executing Data Quality Projects
    Danette McGilvray
    Executing Data Quality Projects
    € 84,94
€ 83,33
Direct te downloaden

Rubrieken

Uw cookie-instellingen
Deze website maakt gebruik van verschillende soorten cookies. Sommige cookies worden geplaatst door diensten van derden die op onze pagina's worden weergegeven. Om deze externe content te kunnen tonen is nodig dat u toestemming geeft voor het zetten van persoonlijke en marketingcookies. U kunt uw toestemming op elk moment wijzigen of intrekken. In onze cookieverklaring vindt u meer informatie.

Functionele cookies
Deze zijn noodzakelijk voor de werking van de website, zonder deze cookies kan de website niet naar behoren werken.

Persoonlijke en marketingcookies
Wij gebruiken cookies voor statistieken om bij te houden en rapportages te krijgen over hoe bezoekers de website gebruiken. Zo kunnen wij onze website verbeteren. Marketingcookies worden gebruikt om bezoekers te volgen wanneer ze verschillende websites bezoeken. Hun doel is advertenties weergeven die zijn toegesneden op en relevant zijn voor de individuele gebruiker.
Op werkdagen voor 23:00 besteld, morgen in huis Gratis verzending vanaf €20

Klantenservice

Contact Voorwaarden

Bezoekadres

Kernreactorstraat 9b
3903 LG  Veenendaal

Postadres

Postbus 623
3900 AP  Veenendaal
DE OPLOSSING VOOR ZORGELOOS EN EFFICIËNT ABONNEMENTENBEHEER
Algemene voorwaarden Privacy Cookies Service & Contact
© 2026 PS Media

    Personen

      Trefwoorden

        Privacy & Data Protection Foundation Courseware

        Privacy & Data Protection Foundation Courseware
        Ruben Zeegers
        /
        loader
        Recensiebeleid
        AI-book

        Wat is een AI-book?

        Een AI-book is niet een boek dat geschreven is door AI maar een boek dat verrijkt is met AI. Het maakt de inhoud van een boek interactief via WhatsApp, zodat je ermee kunt chatten. Zie het als een razend slimme assistent die het boek perfect begrijpt en er alles uit onthouden heeft. Jij kunt deze assistent alles vragen. Vraag bijvoorbeeld hoe je iets kunt toepassen op jouw persoonlijke situatie, om een korte samenvatting, of wat de belangrijkste inzichten zijn. AI-books zijn alleen te gebruiken via WhatsApp, je hoeft er geen aparte app voor te installeren.
        Meer informatie over AI-books

        ?

        Geef uw beoordeling

        Privacy & Data Protection Foundation Courseware

        Verwijder uw beoordeling