Op werkdagen voor 23:00 besteld, morgen in huis Gratis verzending vanaf €20
-
Inloggen

Uw winkelwagen

Naar winkelwagen Verder winkelen
Boek niet gevonden? Wij gaan voor u op zoek!
Vul onderstaand formulier zo volledig mogelijk in, dan gaan wij voor u op zoek.
Vul onderstaand formulier zo volledig mogelijk in.
Contact
010-4091943
Klantenservice
Mijn account
Mijn bestellingen
0318-508539
E-Books IT-management / ICT NIS2 Professional (CNIS2) Courseware
NIS2 Professional (CNIS2) Courseware
NIS2 Professional (CNIS2) Courseware
NIS2 Professional (CNIS2) Courseware
NIS2 Professional (CNIS2) Courseware
Michiel Benda Meer over Michiel Benda
E-book
Michiel Benda

NIS2 Professional (CNIS2) Courseware

Revised Edition

Specificaties
E-book, 188 blz. Pdf met watermerkbeveiliging | Engels
Van Haren Publishing B.V. | 2e druk, 2025
ISBN13: 9789401813617
Rubricering
Hoofdrubriek : Computer en informatica
Van Haren Publishing B.V. Pdf met watermerkbeveiliging 2e druk, 2025 9789401813617
Onderdeel van serie Courseware
Paperback | EN € 111,18 Paperback | EN € 114,40 E-book | EN € 111,18 E-book | EN € 114,40
1e druk | 2025 € 111,18 2e druk | 2025 € 114,40
€ 114,40
In winkelwagen
Direct te downloaden

Samenvatting

Besides the NIS2 Professional (CNIS2) Courseware publication you are advised to obtain the publication “The NIS2 Navigator’s Handbook: Bridging the Cybersecurity GAP. 

This Certified NIS2 Professional course, brought to you by the EU Organisational Compliance Institute. In this course, we address the uncertainties surrounding the European NIS2 directive that many organizations and their management face.

Participants delve into the intricacies of the directive, gaining clarity on its components, obligations, and the roles and responsibilities it entails. Our training kicks off with a comprehensive theoretical overview, laying the groundwork for understanding the NIS2 directive.

Next, participants embark on a practical journey, conducting a GAP analysis tailored to their organization's needs. This analysis helps identify areas of focus, ensuring alignment with NIS2 requirements.

Key Course Highlights:
- Gain insight into the European framework and background of the NIS2 directive.
- Explore the components of the NIS2 directive and understand obligations for essential and important entities.
- Navigate through governance obligations, risk management, policies, procedures, situational plans, and organizational and technical measures.
- Join a course in CNIS2 to equip yourself with the knowledge and tools necessary to navigate the complexities of NIS2 compliance effectively.

Trefwoorden

cybersecuritynis2compliancecertificeringwetgevingeuropees rechtinformatiebeveiligingkritieke infrastructuurrisicoanalyseprofessionele certificeringeuropese wetgevingincidentmanagementict (informatie- en communicatietechnologie)onderwijsrisicomanagementcursusmateriaaltrainingsmateriaalorganisatieveranderingbestuursrechtonderwijsrisicomanagementcursusmateriaaltrainingsmateriaalorganisatieveranderingbestuursrecht
cybersecuritynis2wetgevingcompliancecertificeringeuropees rechtinformatiebeveiligingeuropese wetgevingkritieke infrastructuurrisicoanalyseincidentmanagementprofessionele certificeringrisicomanagementcursusmateriaalorganisatieveranderingonderwijstrainingsmateriaalbestuursrechtict (informatie- en communicatietechnologie)risicomanagementcursusmateriaalorganisatieveranderingonderwijstrainingsmateriaalbestuursrechtict (informatie- en communicatietechnologie)

Specificaties

ISBN13:9789401813617
Taal:Engels
Bindwijze:e-book
Beveiliging:watermerk
Bestandsformaat:pdf
Aantal pagina's:188
Uitgever:Van Haren Publishing B.V.
Druk:2
Verschijningsdatum:15-8-2025
Hoofdrubriek:IT-management / ICT
Serie:Courseware

Anderen die dit e-book kochten, kochten ook

  • The NIS2 Navigator’s Handbook
    Michiel Benda
    The NIS2 Navigator’s Handbook
    € 59,90
  • Adaptive Systems with Domain-Driven Design, Wardley Mapping, and Team Topologies
    Susanne Kaiser
    Adaptive Systems with Domain-Driven Design, Wardley Mapping, and Team Topologies
    € 49,08
  • Executing Data Quality Projects
    Danette McGilvray
    Executing Data Quality Projects
    € 84,94
  • 20 vragen en antwoorden over AI
    Menno Lanting
    20 vragen en antwoorden over AI
    € 20,00
  • De Ai basisgids voor leraren
    Dieter Möckelmann
    De Ai basisgids voor leraren
    € 16,95
  • Hét handboek voor de functioneel beheerder
    Daniël E. Brouwer
    Hét handboek voor de functioneel beheerder
    € 34,99
€ 114,40
Direct te downloaden

Rubrieken

Uw cookie-instellingen
Deze website maakt gebruik van verschillende soorten cookies. Sommige cookies worden geplaatst door diensten van derden die op onze pagina's worden weergegeven. Om deze externe content te kunnen tonen is nodig dat u toestemming geeft voor het zetten van persoonlijke en marketingcookies. U kunt uw toestemming op elk moment wijzigen of intrekken. In onze cookieverklaring vindt u meer informatie.

Functionele cookies
Deze zijn noodzakelijk voor de werking van de website, zonder deze cookies kan de website niet naar behoren werken.

Persoonlijke en marketingcookies
Wij gebruiken cookies voor statistieken om bij te houden en rapportages te krijgen over hoe bezoekers de website gebruiken. Zo kunnen wij onze website verbeteren. Marketingcookies worden gebruikt om bezoekers te volgen wanneer ze verschillende websites bezoeken. Hun doel is advertenties weergeven die zijn toegesneden op en relevant zijn voor de individuele gebruiker.
Op werkdagen voor 23:00 besteld, morgen in huis Gratis verzending vanaf €20

Klantenservice

Contact Voorwaarden

Bezoekadres

Kernreactorstraat 9b
3903 LG  Veenendaal

Postadres

Postbus 623
3900 AP  Veenendaal
DE OPLOSSING VOOR ZORGELOOS EN EFFICIËNT ABONNEMENTENBEHEER
Algemene voorwaarden Privacy Cookies Service & Contact
© 2026 PS Media

    Personen

      Trefwoorden

        NIS2 Professional (CNIS2) Courseware

        NIS2 Professional (CNIS2) Courseware
        Michiel Benda
        /
        loader
        Recensiebeleid
        AI-book

        Wat is een AI-book?

        Een AI-book is niet een boek dat geschreven is door AI maar een boek dat verrijkt is met AI. Het maakt de inhoud van een boek interactief via WhatsApp, zodat je ermee kunt chatten. Zie het als een razend slimme assistent die het boek perfect begrijpt en er alles uit onthouden heeft. Jij kunt deze assistent alles vragen. Vraag bijvoorbeeld hoe je iets kunt toepassen op jouw persoonlijke situatie, om een korte samenvatting, of wat de belangrijkste inzichten zijn. AI-books zijn alleen te gebruiken via WhatsApp, je hoeft er geen aparte app voor te installeren.
        Meer informatie over AI-books

        ?

        Geef uw beoordeling

        NIS2 Professional (CNIS2) Courseware

        Verwijder uw beoordeling